PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013634786.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 290aa    MW: 32687.9 Da    PI: 8.2825
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013634786.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.9e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+++Ed  l+d++++ G+g +W + +++ g++R++k+c++rw++yl
   XP_013634786.1 14 RGPWSPDEDATLKDYIEKKGTGgNWIALPQKAGLRRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding43.29.3e-1469111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eEd+++  +++  G++ W+ Ia+++  gRt++++k++w++
   XP_013634786.1  69 GDFTEEEDKIICSLFASIGSR-WSVIAAHLH-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.93962IPR017930Myb domain
SuperFamilySSF466892.4E-2611109IPR009057Homeodomain-like
SMARTSM007172.8E-101364IPR001005SANT/Myb domain
PfamPF002495.9E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-221569IPR009057Homeodomain-like
CDDcd001675.61E-71662No hitNo description
PROSITE profilePS5129421.47963117IPR017930Myb domain
SMARTSM007178.0E-1267115IPR001005SANT/Myb domain
PfamPF002491.1E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-2470117IPR009057Homeodomain-like
CDDcd001671.87E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPD EDATLKDYIE KKGTGGNWIA LPQKAGLRRC GKSCRLRWLN  60
YLRPNLRHGD FTEEEDKIIC SLFASIGSRW SVIAAHLHGR TDNDIKNYWN TKLKKKIIAT  120
MAPPPPHHLL AIASSSSSPS SSSQYNMINS FPYYNPSACT NELIIPPQGM MTMMDQQQHL  180
LYQEHMGNLG NSPSSNKLIM SHQEDSPKQS ASKGIMLLSD VRSGSSSTTS TVARVKSKHH  240
DYHHEEEGRS MEDYGMDEIK QLISSNCTSS SSNSLWFDEN KTEDKFMMYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-22141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896300.0AC189630.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS003G14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634786.10.0PREDICTED: transcription factor RAX2-like
SwissprotQ9SJL71e-130RAX2_ARATH; Transcription factor RAX2
TrEMBLA0A0D3C4N00.0A0A0D3C4N0_BRAOL; Uncharacterized protein
STRINGBra017218.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.11e-119MYB family protein